Free seo analysis of Alltechbuzz.net

1.19

alltechbuzz.net alltechbuzz.net

Last Analyzed : 2017.06.21

Alltechbuzz.net has a estimated value of $266,898. It receives around 26,478 unique visitors per day and 158,868 daily page views which may earn a revenue of $317.74/day from different advertising sources. Having 76,240 organic keywords in top Google Search results. Estimated Traffic received from these keywords via top Google Search 51,115. Estimated price of organic keywords in Google AdWords $33,863. Alexa world traffic rank is 15,243 and Alexa India rank is 3,707. Page speed score of 72 out of 100. Moz Domain Authority of 47.7 and Page Authority of 43.3 out of 100.

It was registered 5 years, 0 months, 20 days ago. Domain name registered at GODADDY.COM, LLC on server whois.godaddy.com Domain hosted on ip address 104.20.186.69.


Stats

Moz Rank

Moz Da

Moz PA

Page Speed

Code Text Ratio %

Page Size(kb)

Top Keywords in Search
Keyword Position Traffic % Keyword Cost Traffic Cost Query Vol. Results
prank calling app 11 5.56 0.59 4.95 60500 1030000
proxy sites 4 5.54 1.74 14.56 40500 59200000
upload pictures to snapchat 9 4.34 0.71 4.65 74000 7050000
music without wifi 11 3.72 0.58 3.26 40500 12200000
snapchat upload from gallery 7 2.12 0.36 1.15 27100 644000
proxy websites 3 1.74 1.60 4.20 9900 25700000
snapchat upload 15 1.07 1.06 1.72 110000 1410000
proxy site 8 1.06 1.74 2.78 18100 32300000
awesome profile pics 1 0.91 0.00 0.00 1000 39900000
music apps that dont need wifi 4 0.73 0.93 1.03 5400 23400000
best proxy sites 1 0.66 1.11 1.10 720 7390000
whatsapp profile picture 1 0.66 0.13 0.12 720 3530000
how to upload pictures to snapchat 7 0.63 0.00 0.00 8100 982000
how to post pictures on snapchat 8 0.58 0.00 0.00 9900 4180000
xcode for windows 4 0.49 6.48 4.81 3600 747000
proxy site list 2 0.48 1.99 1.44 1900 29700000
best proxy server 2 0.48 2.63 1.91 1900 0
how to upload photos to snapchat 9 0.47 0.00 0.00 8100 3680000
proxy server list 8 0.47 2.80 2.00 8100 0
no wifi music apps 11 0.40 0.78 0.47 4400 9240000
profile pic 4 0.39 0.07 0.04 2900 62700000
proxy sites list 1 0.35 1.23 0.66 390 31000000
proxy server websites 1 0.35 2.82 1.52 390 3790000
gallery to snapchat 6 0.35 0.52 0.27 3600 12700000
profile pics 5 0.35 0.79 0.41 3600 62300000
Alexa stats
Alexa rank 15,243
Alexa index change -16,359
Alexa India rank 3,707
Pagerank 3
Sistrix rank 0,03
Site Speed Report
Google PageSpeed 72
Server Response Time 1.33s
Actual Page Load Time
Semrush stats
SemRush rank 31,589
Organic Keywords 76,240
Organic Traffic 51,115
Organic Cost $33,863
Moz stats
Moz Domain authority 47.7
Moz Page authority 43.3
Moz Page Rank 3.87
Backlinks stats
(Alexa) Sites linking in 3,251
(Moz) backlinks 27
(Semrush) backlinks 3,077
Dofollow backlinks 2,254
Nofollow backlinks 823
Domains linking 442
Ips linking 424

Backlinks
https://mail.google.com/_/scs/mail-static/_/js/k=gmail.main.en.Az9C4K3BfFw.O/m=m_i,pdt,t,it/am=yOLiAPJkvD-IkwFAWekEhdn3zyGXygf73CP9iQcECvoJ-L_Z_wP8HwAAAAB2UYMC/rt=h/d=1/rs=AHGWq9AGMMdSZeE08LGCUQIsRfrvyp0bIQ
youtube.com/mobile
facebook.com/
baidu.com/link?url=3sMJ9PEvQOGQOGElTlbZHxcOVDkntE37YJqGb2RDsgTq_FTunPpG0E0fpaa-VaH1qcx7iQePftjbep6q95Sx93a41Akk68DN8QkellqYjjK&wd=&eqid=b659fd8f0000896c00000004590ed38e
cmpui.adx.vip.bf1.yahoo.com:9999/falcon/
https://reddit.com/?count=25&after=t3_5zl6ua
https://mobile.twitter.com/1sInto2s?p=s
https://amazon.com/Alfa-AWUSO36NH-Wireless-Long-Rang-Network/dp/B0035APGP6/ref=sr_1_1
https://onenote.officeapps.live.com/
away.vk.com/away.php
instagram.com/
https://linkedin.com/
https://yandex.ru/
https://t.co/2XAcKit0F7
****hub.com/interstitial?viewkey=ph566775972f9ca
https://msn.com/spartan/ntp?locale=de-DE&market=DE&enableregulatorypsm=0
https://support.microsoft.com/en-us/contact/virtual-agent/?ws=support
go.mail.ru/
https://ok.ru/
https://stackoverflow.com/questions/36163806/how-to-compile-a-unity-vuforia-project-to-ios-on-windows
gmziy.com/
mbcradio.com/
valentinesdayromantic.com/
socialcomp***.com/function.file-get-contents
gingercreek.org/
netilligence.ae/?key=windows-8-product-key-sale
superbowl2016livestreami.com/
alltechmedia.org/blogging-consultancy/
fulltechtricks.com/event-based-niche-blogging.html
xceltrait.com/index.php
web.blogads.com/blog-partners
akademiasupraska.pl/pages/?salekey=Office-2010-product-key
susanlattadesign.com/?p=buy-windows-10-product-key
dr-bea.cl/drbea-wp/?p=583
bear-house.com/?p=buy-windows-10-product-key
mcic1.org/?win=windows-10-activation-key
allindiaroundup.com/about/
tamestylebar.com/?p=buy-windows-10-product-key
wojus.com/2015/12/gmailcom-log-in-wwwgmailcom-login.html
novoton.pl/?p=buy-windows-10-product-key
happylohriimages.com/
valentinesdayquotesh.com/
bestindiansites.com/feed/
thedrawingshed.org/?win=windows-10-activation-keys
bali3tour-travel.com/
kuracja-neera.pl/?p=buy-windows-10-product-key
emagine.ws/?free=windows-10-key
sslcresult2016.net/
vita-pakt.com/?free=Windows-10-iso
bfrepair.com/?p=buy-windows-10-product-key
brothersboxofficecollection.com/
asmarterplanet.com/blog/2013/02/the-mobile-enterprise-puts-business-leaders-on-the-hot-seat.html
simplystaugustine.com/?free=Windows-10-key
it.ifairpeople.com/?p=buy-windows-10-product-key
imemorialday2015.com/
happydiwali2015imagespics.com/
happyfriendshipdaymessageshq.com/
blogherald.com/2015/01/05/google-panda-effect-can-fight-back/
hilarytheguy.blogspot.ro/2014/12/free-product-key-for-windows-8.html
dojlidy.cerkiew.pl/pages/index.php?key=windows-10-RTM-key
Traffic
Daily Unique Visitors 26478
Daily Page Views 158868
Income per day 317.74
Countries Map
TRAFFIC ANALYSIS
Country Users Pageviews Rank
 United States of America 30.97% 31.42% 5546
 India 16.98% 16.81% 3707
 Czech Republic 8.11% 7.01% 649
 Canada 5.58% 5.50% 3175
 France, French Republic 4.84% 4.99% 5912
 Italy 4.57% 4.26% 4772
 United Kingdom 2.05% 1.99% 13772
 Russian Federation 1.98% 2.08% 15980
 Vietnam 1.85% 2.08% 2697
 Germany 1.83% 1.89% 18392
 Brazil 1.60% 1.59% 12168
 Pakistan 1.44% 1.52% 4425
 Bulgaria 1.26% 1.13% 1696
 Romania 0.88% 0.92% 5301
 Turkey 0.69% 0.73% 12893
 Egypt 0.65% 0.72% 7968
 Netherlands the 0.61% 0.64% 13343
 Indonesia 0.60% 0.64% 14006
 Spain 0.59% 0.62% 28866
 Taiwan 0.57% 0.63% 13177
 Australia 0.56% 0.54% 17927
 Singapore 0.53% 0.56% 7609
 Thailand 0.51% 0.57% 10934
 Philippines 0.47% 0.50% 6984
 Ukraine 0.42% 0.45% 10935
 Bangladesh 0.39% 0.42% 5991
 Morocco 0.35% 0.37% 5320
 Algeria 0.35% 0.37% 7227
 Nepal 0.34% 0.36% 1221
 Venezuela 0.33% 0.33% 9580
 Malaysia 0.33% 0.34% 11845
 Poland 0.33% 0.34% 30313
 Iran 0.31% 0.33% 40888
 Japan 0.29% 0.30% 125975
 South Africa 0.29% 0.30% 17087
 United Arab Emirates 0.29% 0.31% 8555
 Slovakia (Slovak Republic) 0.26% 0.24% 10530
 Saudi Arabia 0.24% 0.24% 19387
 China 0.23% 0.24% 152196
 Greece 0.23% 0.23% 20697
 Mexico 0.22% 0.23% 37747
 Portugal, Portuguese Republic 0.21% 0.21% 15689
 Ireland 0.20% 0.19% 14437
 Sri Lanka 0.18% 0.19% 6794
 Nigeria 0.18% 0.19% 20415
 Lithuania 0.17% 0.20% 7465
 Argentina 0.15% 0.16% 29151
 Albania 0.15% 0.16% 2827
 Serbia 0.14% 0.14% 11016
 Colombia 0.14% 0.14% 20773
 Dominican Republic 0.13% 0.13% 8797
 Azerbaijan 0.13% 0.14% 22700
 Sweden 0.12% 0.13% 30886
 Hong Kong 0.12% 0.13% 31673
 Korea 0.11% 0.11% 73549
 Peru 0.11% 0.11% 19518
 Qatar 0.11% 0.10% 17092
 Kenya 0.11% 0.12% 6545
 Tunisia 0.10% 0.11% 9843
 Hungary 0.10% 0.10% 25201
 Switzerland, Swiss Confederation 0.10% 0.10% 36870
 Israel 0.09% 0.09% 27715
 Belgium 0.09% 0.10% 46433
 Latvia 0.09% 0.10% 8323
 Macedonia 0.08% 0.10% 4158
 Cambodia 0.08% 0.08% 5214
 Denmark 0.08% 0.08% 28450
 Finland 0.07% 0.07% 34999
 New Zealand 0.07% 0.07% 17377
 Georgia 0.07% 0.07% 5196
 Kuwait 0.06% 0.06% 20418
 Croatia 0.06% 0.06% 17353
 Austria 0.06% 0.06% 65393
 Slovenia 0.06% 0.06% 14881
 Jordan 0.06% 0.07% 6577
 Norway 0.05% 0.06% 42946
Traffic Source & Visits Stats
Majestic Daily Backlinks graph
Semrush graph
SEMRush Domain Trend Graph for alltechbuzz.net
SEMRush Domain Trend Graph for alltechbuzz.net
SEMRush Domain Trend Graph for alltechbuzz.net
SEMRush Domain Trend Graph for alltechbuzz.net
SEMRush Domain Trend Graph for alltechbuzz.net
Metatag
Title All Tech Buzz - Best Tips and Tricks on Internet
Description All Tech Buzz is a Web Magazine for Geeks and Bloggers. Here we feature tricks related to Social Media, How to Blog Tips, Web Apps, Software Solutions and much more.
Inpage analysis
H1 8
H2 12
H3 0
H4 8
Page Size 123.3kb
Code Size 113.8kb
Text Size 9.5kb
Code to Text Ratio 7.71%
Images 87
Frames 0
Size Chart
Text Code Analysis
Social
Facebook likes 603
Facebook shares 519
Facebook comments 25
Tweets N/A
Google+1 1872
Linkedin 19
Pinterest 0
StumbleUpon 1
Digg N/A
Delicious N/A
Vkontakte 0
Safety information
Google safe browsing The website is not blacklisted and looks safe to use.
Wot Trustworthiness Unsatisfactory Unsatisfactory
Wot child safety Good Good
Alexa graph
Search Visits
Alexa Statistics Graph for alltechbuzz.net
Daily Traffic Trend
Alexa Statistics Graph for alltechbuzz.net
HTTP header response
HTTP/1.1 301 Moved Permanently
Date: Wed, 21 Jun 2017 10:09:38 GMT
Content-Type: text/html
Transfer-Encoding: chunked
Connection: keep-alive
Set-Cookie: __cfduid=d2b4e2cec54729986e7a48ebb6e8a96721498039778; expires=Thu, 21-Jun-18 10:09:38 GMT; path=/; domain=.alltechbuzz.net; HttpOnly
Location: https://www.alltechbuzz.net/
Content-Security-Policy: default-src 'self' https: data: 'unsafe-inline' 'unsafe-eval';
X-Xss-Protection: 1; mode=block
X-Content-Type-Options: nosniff
Strict-Transport-Security: max-age=31536000; includeSubdomains
Server: cloudflare-nginx
CF-RAY: 37262c68641839a6-PHX

HTTP/1.1 200 OK
Date: Wed, 21 Jun 2017 10:09:39 GMT
Content-Type: text/html; charset=UTF-8
Transfer-Encoding: chunked
Connection: keep-alive
Set-Cookie: __cfduid=da844bd455ea5d1252398f7f306db245b1498039779; expires=Thu, 21-Jun-18 10:09:39 GMT; path=/; domain=.alltechbuzz.net; HttpOnly
Link: <https://www.alltechbuzz.net/wp-json/>; rel="https://api.w.org/"
Content-Security-Policy: default-src 'self' https: data: 'unsafe-inline' 'unsafe-eval';
X-Xss-Protection: 1; mode=block
X-Content-Type-Options: nosniff
Fastcgi-Cache: HIT
Strict-Transport-Security: max-age=31536000; includeSubdomains
Server: cloudflare-nginx
CF-RAY: 37262c6b1d3839be-PHX

IP info
IP Address 104.20.186.69
City San Francisco
State California
State code CA
Country United States
Country code US
Zipcode 94107
Lat 37.7697
Lng -122.3933
DNS Info
Type Class TTL Target
A IN 299
A IN 299
NS IN 86399 ed.ns.cloudflare.com
NS IN 86399 sara.ns.cloudflare.com
SOA IN 3599
MX IN 299 alt3.aspmx.l.google.com
MX IN 299 aspmx.l.google.com
MX IN 299 alt4.aspmx.l.google.com
MX IN 299 alt1.aspmx.l.google.com
MX IN 299 alt2.aspmx.l.google.com
TXT IN 299
AAAA IN 299
AAAA IN 299
Whois data
Registrar GODADDY.COM, LLC
Created 2012-06-07 00:00:00 5 years, 0 months, 20 days ago.
Changed 2017-05-30 00:00:00 0 years, 0 months, 28 days ago.
Expires 2018-06-07 00:00:00 0 years, 11 months, 10 from now.
Whois server whois.godaddy.com
Whois raw
Domain Name: alltechbuzz.net
Registrar URL: http://www.godaddy.com
Registrant Name: Registration Private
Registrant Organization: Domains By Proxy, LLC
Name Server: ED.NS.CLOUDFLARE.COM
Name Server: SARA.NS.CLOUDFLARE.COM
DNSSEC: unsigned

For complete domain details go to:
http://who.godaddy.com/whoischeck.aspx?domain=alltechbuzz.net

The data contained in GoDaddy.com, LLC's WhoIs database,
while believed by the company to be reliable, is provided "as is"
with no guarantee or warranties regarding its accuracy.  This
information is provided for the sole purpose of assisting you
in obtaining information about domain name registration records.
Any use of this data for any other purpose is expressly forbidden without the prior written
permission of GoDaddy.com, LLC.  By submitting an inquiry,
you agree to these terms of usage and limitations of warranty.  In particular,
you agree not to use this data to allow, enable, or otherwise make possible,
dissemination or collection of this data, in part or in its entirety, for any
purpose, such as the transmission of unsolicited advertising and
and solicitations of any kind, including spam.  You further agree
not to use this data to enable high volume, automated or robotic electronic
processes designed to collect or compile this data for any purpose,
including mining this data for your own personal or commercial purposes. 

Please note: the registrant of the domain name is specified
in the "registrant" section.  In most cases, GoDaddy.com, LLC 
is not the registrant of domain names listed in this database.


Customized stats bar for your website